RSS
email

Mutações

Anomalias Monogenéticas e Multifactoriais

Cerca de 1400 doenças genéticas conhecidas são causadas por mutações em genes únicos. As lesões bioquímicas de mais de 250 destas doenças são conhecidas e afectam sobretudo enzimas, factores de coagulação do sangue, proteínas de transporte, hormonas peptídicas, receptores.

As doenças monogénicas podem não ser herdadas, mas serem antes o resultado de uma nova mutação no indivíduo afectado. A frequência da ocorrência deste género de mutações foi calculada como sendo de 5 x 10-6 mutação por gene e por geração. Aproximadamente um em cada 100.000 recém-nascidos deveria, portanto, possuir uma nova mutação num qualquer locus genético.


ß-talassemias

Talassemias são pertubações genéticas da síntese de hemoglobina. As hemoglobinas humanas são codificadas por duas séries de genes: os genes de tipo a, localizados no cromossoma 10 e os genes de tipo ß, localizados no cromossoma 11

As talassemias são patalogias caracterizadas pela ausência total ou parcial de síntese de um tipo de globina. O resultado é um desequilíbrio entre as cadeias a e ß e uma anemia. Estes estados têm origem numa deficiência de transcrição do DNA, ou num defeito de maturação do RNA, ou numa instabilidade do RNA ou, ainda, numa incorrecção na tradução do RNA. Estes defeitos podem resultar de mutações pontuais que conduzem a um desfasamento da tradução ou ao aparecimento prematuro de sinais de fim de cadeia ou, ainda, derivar de eliminações do gene, no seu todo ou parciais.

Mutações sem sentido e frame shift

A ß-talassemia, caracterizada pela ausência total da síntese da globina ß, resulta duma mutação pontual no codão correspondente ao aminoácido 17 ou no correspondente ao aminoácido 39. Nos dois casos, a mutação dá origem a um codão sem sentido. Para além de serem intraduzíveis, os RNA mensageiros correspondentes são muito instáveis in vivo.

Outras talassemias de tipo ß resultam de eliminações ou de inserções na sequência que codifica para a globina ß; o resultado é uma deslocação da fase de leitura do RNA mensageiro.


Um exemplo de favorecimento

Aqui temos a tabela dos tripletos. Há três tripletos de terminação de cadeia proteica. Se, por exemplo na CCR5 um destes codões aparecer antes do esperado teremos, então, uma proteína não funcional. Uma mutação poderá favorecer o portador de tal mutação, fazendo com que este não seja afectado pelo vírus do HIV, mas seja apenas portador, por exemplo.

Sequência proteica de CCR5:

>Q5EKN0|Q5EKN0_HUMAN CC chemokine receptor 5 variant - Homo sapiens
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFIIL
LTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSH
FPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIM
IVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVG
EKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Bibliografia:

Sebenta de “Tecnologia de DNA Recombinante” Prof. Doutor Alfredo J. M. Cravador

http://beta.uniprot.org/


Bookmark and Share

1 comentários:

Marcos Sabino disse...

A coisa boa no meio de tudo isto é que eu ainda acredito que os cientistas consigam conceber uma cura para o HIV

:)

07/03/2008

Mutações

Anomalias Monogenéticas e Multifactoriais

Cerca de 1400 doenças genéticas conhecidas são causadas por mutações em genes únicos. As lesões bioquímicas de mais de 250 destas doenças são conhecidas e afectam sobretudo enzimas, factores de coagulação do sangue, proteínas de transporte, hormonas peptídicas, receptores.

As doenças monogénicas podem não ser herdadas, mas serem antes o resultado de uma nova mutação no indivíduo afectado. A frequência da ocorrência deste género de mutações foi calculada como sendo de 5 x 10-6 mutação por gene e por geração. Aproximadamente um em cada 100.000 recém-nascidos deveria, portanto, possuir uma nova mutação num qualquer locus genético.


ß-talassemias

Talassemias são pertubações genéticas da síntese de hemoglobina. As hemoglobinas humanas são codificadas por duas séries de genes: os genes de tipo a, localizados no cromossoma 10 e os genes de tipo ß, localizados no cromossoma 11

As talassemias são patalogias caracterizadas pela ausência total ou parcial de síntese de um tipo de globina. O resultado é um desequilíbrio entre as cadeias a e ß e uma anemia. Estes estados têm origem numa deficiência de transcrição do DNA, ou num defeito de maturação do RNA, ou numa instabilidade do RNA ou, ainda, numa incorrecção na tradução do RNA. Estes defeitos podem resultar de mutações pontuais que conduzem a um desfasamento da tradução ou ao aparecimento prematuro de sinais de fim de cadeia ou, ainda, derivar de eliminações do gene, no seu todo ou parciais.

Mutações sem sentido e frame shift

A ß-talassemia, caracterizada pela ausência total da síntese da globina ß, resulta duma mutação pontual no codão correspondente ao aminoácido 17 ou no correspondente ao aminoácido 39. Nos dois casos, a mutação dá origem a um codão sem sentido. Para além de serem intraduzíveis, os RNA mensageiros correspondentes são muito instáveis in vivo.

Outras talassemias de tipo ß resultam de eliminações ou de inserções na sequência que codifica para a globina ß; o resultado é uma deslocação da fase de leitura do RNA mensageiro.


Um exemplo de favorecimento

Aqui temos a tabela dos tripletos. Há três tripletos de terminação de cadeia proteica. Se, por exemplo na CCR5 um destes codões aparecer antes do esperado teremos, então, uma proteína não funcional. Uma mutação poderá favorecer o portador de tal mutação, fazendo com que este não seja afectado pelo vírus do HIV, mas seja apenas portador, por exemplo.

Sequência proteica de CCR5:

>Q5EKN0|Q5EKN0_HUMAN CC chemokine receptor 5 variant - Homo sapiens
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFIIL
LTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSH
FPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIM
IVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVG
EKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Bibliografia:

Sebenta de “Tecnologia de DNA Recombinante” Prof. Doutor Alfredo J. M. Cravador

http://beta.uniprot.org/

1 comentários:

Marcos Sabino disse...

A coisa boa no meio de tudo isto é que eu ainda acredito que os cientistas consigam conceber uma cura para o HIV

:)

Related Posts Widget for Blogs by LinkWithin